CLDN2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14085P
Artikelname: CLDN2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14085P
Hersteller Artikelnummer: CNA14085P
Alternativnummer: MBL-CNA14085P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence within amino acids 151-230 of human CLDN2 (NP_001164563.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 25kDa
NCBI: 9075
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: LVPDSMKFEIGEALYLGIISSLFSLIAGIILCFSCSSQRNRSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYV
Target-Kategorie: CLDN2
Application Verdünnung: WB: WB,1:100 - 1:500