STIP1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14106S
Artikelname: STIP1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14106S
Hersteller Artikelnummer: CNA14106S
Alternativnummer: MBL-CNA14106S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, IP, WB
Spezies Reaktivität: Human, Monkey, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human STIP1 (NP_006810.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 63kDa
NCBI: 10963
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MEQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNMPNLYQKLESDPRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRIMTTLSVLLGVDLGSMDEEEEIATPPPPPPPKKETKPEPMEEDLPENKKQALKEKELGNDAYKKKDFDTALKHYDKAKEL
Target-Kategorie: STIP1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:20 - 1:50