SLAMF7 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14144T
Artikelname: SLAMF7 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14144T
Hersteller Artikelnummer: CNA14144T
Alternativnummer: MBL-CNA14144T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 23-226 of human SLAMF7 (NP_067004.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 37kDa
NCBI: 57823
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSM
Target-Kategorie: SLAMF7
Application Verdünnung: WB: WB,1:500 - 1:1000