PKC zeta Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14178T
Artikelname: PKC zeta Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14178T
Hersteller Artikelnummer: CNA14178T
Alternativnummer: MBL-CNA14178T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 476-547 of human PKC zeta (NP_002735.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 68kDa
NCBI: 5590
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: RIPRFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQITDDYGLDN
Target-Kategorie: PRKCZ
Application Verdünnung: WB: WB,1:100 - 1:500