AT1R/AGTR1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14201P
Artikelname: AT1R/AGTR1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14201P
Hersteller Artikelnummer: CNA14201P
Alternativnummer: MBL-CNA14201P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 294-388 of human AT1R/AGTR1 (NP_114438.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 41kDa
NCBI: 185
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: LIQLGIIRDCRIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSTKKPAPCFEVE
Target-Kategorie: AGTR1
Application Verdünnung: WB: WB,1:500 - 1:1000