WDR33 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14208T
Artikelname: WDR33 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14208T
Hersteller Artikelnummer: CNA14208T
Alternativnummer: MBL-CNA14208T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-208 of mouse WDR33 (NP_001164437.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 30kDa/38kDa/145kDa
NCBI: 74320
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MATEIGSPPRFFHMPRFQHQAPRQLFYKRPDFAQQQAMQQLTFDGKRMRKAVNRKTIDYNPSVIKYLENRIWQRDQRDMRAIQPDAGYYNDLVPPIGMLNNPMNAVTTKFVRTSTNKVKCPVFVVRWTPEGRRLVTGASSGEFTLWNGLTFNFETILQAHDSPVRAMTWSHNDMWMLTADHGGYVKYWQSNMNNVKMFQAHKEAIREA
Target-Kategorie: Wdr33
Application Verdünnung: WB: WB,1:500 - 1:2000