Cyclin E1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14225P
Artikelname: Cyclin E1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14225P
Hersteller Artikelnummer: CNA14225P
Alternativnummer: MBL-CNA14225P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human Cyclin E1 (NP_001229.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 47kDa
NCBI: 898
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: AASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNIQTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSG
Target-Kategorie: CCNE1
Application Verdünnung: WB: WB,1:500 - 1:1000