GUCY2F Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14242T
Artikelname: GUCY2F Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14242T
Hersteller Artikelnummer: CNA14242T
Alternativnummer: MBL-CNA14242T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 250-460 of human GUCY2F (NP_001513.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 125kDa
NCBI: 2986
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: HSALIGGETQMHLLECAHDLKMTDGTYVFVPYDALLYSLPYKHTPYRVLRNNPKLREAYDAVLTITVESQEKTFYQAFTEAAARGEIPEKLEFDQVSPLFGTIYNSIYFIAQAMNNAMKENGQAGAASLVQHSRNMQFHGFNQLMRTDSNGNGISEYVILDTNLKEWELHSTYTVDMEMELLRFGGTPIHFPGGRPPRADAKCWFAEGKIC
Target-Kategorie: GUCY2F
Application Verdünnung: WB: WB,1:500 - 1:2000