TSPAN31 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14256T
Artikelname: TSPAN31 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14256T
Hersteller Artikelnummer: CNA14256T
Alternativnummer: MBL-CNA14256T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 95-175 of human TSPAN31 (NP_005972.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 23kDa
NCBI: 6302
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: SCLAINRSKQTDVINASWWVMSNKTRDELERSFDCCGLFNLTTLYQQDYDFCTAICKSQSPTCQMCGEKFLKHSDEALKIL
Target-Kategorie: TSPAN31
Application Verdünnung: WB: WB,1:500 - 1:2000