TNFRSF25 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14261T
Artikelname: TNFRSF25 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14261T
Hersteller Artikelnummer: CNA14261T
Alternativnummer: MBL-CNA14261T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 25-190 of human TNFRSF25 (NP_683866.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 45kDa
NCBI: 8718
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: QGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTPPPSLAGAP
Target-Kategorie: TNFRSF25
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200