MAN1A2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14271T
Artikelname: MAN1A2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14271T
Hersteller Artikelnummer: CNA14271T
Alternativnummer: MBL-CNA14271T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 60-180 of human MAN1A2 (NP_006690.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 73kDa
NCBI: 10905
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: SSKHKRFDLGLEDVLIPHVDAGKGAKNPGVFLIHGPDEHRHREEEERLRNKIRADHEKALEEAKEKLRKSREEIRAEIQTEKNKVVQEMKIKENKPLPPVPIPNLVGIRGGDPEDNDIREK
Target-Kategorie: MAN1A2
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200