CNTN6 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14275T
Artikelname: CNTN6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14275T
Hersteller Artikelnummer: CNA14275T
Alternativnummer: MBL-CNA14275T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 20-110 of human CNTN6 (NP_055276.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 114kDa
NCBI: 27255
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: DGLLSRPIFTQEPHDVIFPLDLSKSEVILNCAANGYPSPHYRWKQNGTDIDFTMSYHYRLDGGSLAINSPHTDQDIGMYQCLATNLLGTIL
Target-Kategorie: CNTN6
Application Verdünnung: WB: WB,1:500 - 1:1000