MRPS2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14279T
Artikelname: MRPS2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14279T
Hersteller Artikelnummer: CNA14279T
Alternativnummer: MBL-CNA14279T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-296 of human MRPS2 (NP_057118.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 33kDa
NCBI: 51116
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MATSSAALPRILGAGARAPSRWLGFLGKATPRPARPSRRTLGSATALMIRESEDSTDFNDKILNEPLKHSDFFNVKELFSVRSLFDARVHLGHKAGCRHRFMEPYIFGSRLDHDIIDLEQTATHLQLALNFTAHMAYRKGIILFISRNRQFSYLIENMARDCGEYAHTRYFRGGMLTNARLLFGPTVRLPDLIIFLHTLNNIFEPHVAVRDAAKMNIPTVGIVDTNCNPCLITYPVPGNDDSPLAVHLYCRLFQ
Target-Kategorie: MRPS2
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200