ADH1B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1431S
Artikelname: ADH1B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1431S
Hersteller Artikelnummer: CNA1431S
Alternativnummer: MBL-CNA1431S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 206-375 of human ADH1B (NP_000659.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 40kDa
NCBI: 125
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: LSAVMGCKAAGAARIIAVDINKDKFAKAKELGATECINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPASQNLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHVLPFEKINEGFDLLHSGKSIRTVLTF
Target-Kategorie: ADH1B
Application Verdünnung: WB: WB,1:500 - 1:2000