RABL3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14327T
Artikelname: RABL3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14327T
Hersteller Artikelnummer: CNA14327T
Alternativnummer: MBL-CNA14327T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-236 of human RABL3 (NP_776186.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 26kDa
NCBI: 285282
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MASLDRVKVLVLGDSGVGKSSLVHLLCQNQVLGNPSWTVGCSVDVRVHDYKEGTPEEKTYYIELWDVGGSVGSASSVKSTRAVFYNSVNGIIFVHDLTNKKSSQNLRRWSLEALNRDLVPTGVLVTNGDYDQEQFADNQIPLLVIGTKLDQIHETKRHEVLTRTAFLAEDFNPEEINLDCTNPRYLAAGSSNAVKLSRFFDKVIEKRYFLREGNQIPGFPDRKRFGAGTLKSLHYD
Target-Kategorie: RABL3
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200