NECAP2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14346T
Artikelname: NECAP2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14346T
Hersteller Artikelnummer: CNA14346T
Alternativnummer: MBL-CNA14346T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 194-263 of human NECAP2 (NP_060560.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 28kDa
NCBI: 55707
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: GKTSTLIPPPGEQLAVGGSLVQPAVAPSSGGAPVPWPQPNPATADIWGDFTKSTGSTSSQTQPGTGWVQF
Target-Kategorie: NECAP2
Application Verdünnung: WB: WB,1:500 - 1:2000