PREPL Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14348T
Artikelname: PREPL Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14348T
Hersteller Artikelnummer: CNA14348T
Alternativnummer: MBL-CNA14348T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 578-727 of human PREPL (NP_006027.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 84kDa
NCBI: 9581
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: AVTLEAPFLDVLNTMMDTTLPLTLEELEEWGNPSSDEKHKNYIKRYCPYQNIKPQHYPSIHITAYENDERVPLKGIVSYTEKLKEAIAEHAKDTGEGYQTPNIILDIQPGGNHVIEDSHKKITAQIKFLYEELGLDSTSVFEDLKKYLKF
Target-Kategorie: PREPL
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:100