RPL36AL Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14366T
Artikelname: RPL36AL Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14366T
Hersteller Artikelnummer: CNA14366T
Alternativnummer: MBL-CNA14366T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-106 of human RPL36AL (NP_000992.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 12kDa
NCBI: 6166
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQGRRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF
Target-Kategorie: RPL36AL
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:100