FTO Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1438T
Artikelname: FTO Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1438T
Hersteller Artikelnummer: CNA1438T
Alternativnummer: MBL-CNA1438T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human FTO (NP_001073901.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 58kDa
NCBI: 79068
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MKRTPTAEEREREAKKLRLLEELEDTWLPYLTPKDDEFYQQWQLKYPKLILREASSVSEELHKEVQEAFLTLHKHGCLFRDLVRIQGKDLLTPVSRILIGNPGCTYKYLNTRLFTVPWPVKGSNIKHTEAEIAAACETFLKLNDYLQIETIQALEELAAKEKANEDAVPLCMSADFPRVGMGSSYNGQDEVDIKSRAAYNVTLLNFMDPQKMPYLKEEPYFGMGKMAVSWHHDENLVDRS
Target-Kategorie: FTO
Application Verdünnung: WB: WB,1:500 - 1:1000|IP,1:500 - 1:1000