TXNDC12 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14403T
Artikelname: TXNDC12 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14403T
Hersteller Artikelnummer: CNA14403T
Alternativnummer: MBL-CNA14403T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 93-172 of human TXNDC12 (NP_056997.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 19kDa
NCBI: 51060
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: NLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL
Target-Kategorie: TXNDC12
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:100