MIOX Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14409T
Artikelname: MIOX Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14409T
Hersteller Artikelnummer: CNA14409T
Alternativnummer: MBL-CNA14409T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-285 of human MIOX (NP_060054.4).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 33kDa
NCBI: 55586
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MKVTVGPDPSLVYRPDVDPEVAKDKASFRNYTSGPLLDRVFTTYKLMHTHQTVDFVRSKHAQFGGFSYKKMTVMEAVDLLDGLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKDWFHLVGLLHDLGKVLALFGEPQWAVVGDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQPHCGLDRVLMSWGHDEYMYQVMKFNKFSLPPEAFYMIRFHSFYPWHTGRDYQQLCSQQDLAMLPWVREFNKFDL
Target-Kategorie: MIOX
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200