NOL6 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14420T
Artikelname: NOL6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14420T
Hersteller Artikelnummer: CNA14420T
Alternativnummer: MBL-CNA14420T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1032-1146 of human NOL6 (NP_075068.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 128kDa
NCBI: 65083
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: SFCRGLLSQPGPSSLMPVLGYDPPQLYLTQLREAFGDLALFFYDQHGGEVIGVLWKPTSFQPQPFKASSTKGRMVMSRGGELVMVPNVEAILEDFAVLGEGLVQTVEARSERWTV
Target-Kategorie: NOL6
Application Verdünnung: WB: WB,1:500 - 1:2000