ATP6V1G3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14443T
Artikelname: ATP6V1G3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14443T
Hersteller Artikelnummer: CNA14443T
Alternativnummer: MBL-CNA14443T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human ATP6V1G3 (NP_573569.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 14kDa
NCBI: 127124
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MTSQSQGIHQLLQAEKRAKDKLEEAKKRKGKRLKQAKEEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYRATN
Target-Kategorie: ATP6V1G3
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100