CNR1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1447P
Artikelname: CNR1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1447P
Hersteller Artikelnummer: CNA1447P
Alternativnummer: MBL-CNA1447P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 401-472 of human CNR1 (NP_001153698.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 53kDa
NCBI: 1268
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: SKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
Target-Kategorie: CNR1
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200