RNASE3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14489T
Artikelname: RNASE3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14489T
Hersteller Artikelnummer: CNA14489T
Alternativnummer: MBL-CNA14489T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 70-150 of human RNASE3 (NP_002926.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 18kDa
NCBI: 6037
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: FLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDNRDPRDSPRYP
Target-Kategorie: RNASE3
Application Verdünnung: WB: WB,1:500 - 1:1000