SNRPD1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14493P
Artikelname: SNRPD1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14493P
Hersteller Artikelnummer: CNA14493P
Alternativnummer: MBL-CNA14493P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-96 of human SNRPD1 (NP_008869.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 13kDa
NCBI: 6632
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVA
Target-Kategorie: SNRPD1
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200