EIF2S2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14498T
Artikelname: EIF2S2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14498T
Hersteller Artikelnummer: CNA14498T
Alternativnummer: MBL-CNA14498T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-175 of human EIF2S2 (NP_003899.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 38kDa
NCBI: 8894
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEEDTRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKDLKIESDVQEPTEPEDDLDIMLGNKKKKKKNVKFPDEDEILEKDEALEDEDNKKDDGISFSNQTGPAWAGSERDYT
Target-Kategorie: EIF2S2
Application Verdünnung: WB: WB,1:500 - 1:2000