ZAK Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14513T
Artikelname: ZAK Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14513T
Hersteller Artikelnummer: CNA14513T
Alternativnummer: MBL-CNA14513T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 100-312 of human ZAK (NP_598407.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 35kDa/51kDa/91kDa
NCBI: 51776
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: EEMDMDHIMTWATDVAKGMHYLHMEAPVKVIHRDLKSRNVVIAADGVLKICDFGASRFHNHTTHMSLVGTFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLEGLQVAWLVVEKNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNKAEWRCEIEATLERLKKLERDLSFKEQELKERE
Target-Kategorie: MAP3K20
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200