CALM3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14526T
Artikelname: CALM3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14526T
Hersteller Artikelnummer: CNA14526T
Alternativnummer: MBL-CNA14526T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 80-149 of human CALM3 (NP_005175.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 16kDa
NCBI: 808
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: TDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Target-Kategorie: CALM3
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200