Cyclin A1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14529T
Artikelname: Cyclin A1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14529T
Hersteller Artikelnummer: CNA14529T
Alternativnummer: MBL-CNA14529T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 350-450 of human CCNA1 (NP_001104515.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 52kDa
NCBI: 8900
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: YLRRQGVCVRTENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIVPCLSELHKAYLDIPHRPQQAIREKYKASKYL
Target-Kategorie: CCNA1
Application Verdünnung: WB: WB,1:500 - 1:2000