NGDN Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14546T
Artikelname: NGDN Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14546T
Hersteller Artikelnummer: CNA14546T
Alternativnummer: MBL-CNA14546T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 61-209 of human NGDN (NP_001036100.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 36kDa
NCBI: 25983
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: LMYLMDLTHLILDKASGGSLQGHDAVLRLVEIRTVLEKLRPLDQKLKYQIDKLIKTAVTGSLSENDPLRFKPHPSNMMSKLSSEDEEEDEAEDDQSEASGKKSVKGVSKKYVPPRLVPVHYDETEAEREKKRLERAKRRALSSSVIREL
Target-Kategorie: NGDN
Application Verdünnung: WB: WB,1:500 - 1:2000