TOMM22 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14548T
Artikelname: TOMM22 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14548T
Hersteller Artikelnummer: CNA14548T
Alternativnummer: MBL-CNA14548T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-83 of human TOMM22 (NP_064628.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 16kDa
NCBI: 56993
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRA
Target-Kategorie: TOMM22
Application Verdünnung: WB: WB,1:500 - 1:2000