SAA1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14553T
Artikelname: SAA1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14553T
Hersteller Artikelnummer: CNA14553T
Alternativnummer: MBL-CNA14553T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SAA1 (NP_000322.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 12kDa
NCBI: 6288
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISDARENIQRFFGHGAEDSLADQAA
Target-Kategorie: SAA1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200