[KO Validated] CRMP2/DPYSL2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14570T
Artikelname: [KO Validated] CRMP2/DPYSL2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14570T
Hersteller Artikelnummer: CNA14570T
Alternativnummer: MBL-CNA14570T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 400-500 of human CRMP2/CRMP2/DPYSL2 (NP_001377.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 62kDa
NCBI: 1808
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: RIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAELRGVPRGLYD
Target-Kategorie: DPYSL2
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:500