FBXL12 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14589T
Artikelname: FBXL12 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14589T
Hersteller Artikelnummer: CNA14589T
Alternativnummer: MBL-CNA14589T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-326 of human FBXL12 (NP_060173.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 37kDa
NCBI: 54850
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MATLVELPDSVLLEIFSYLPVRDRIRISRVCHRWKRLVDDRWLWRHVDLTLYTMRPKVMWHLLRRYMASRLHSLRMGGYLFSGSQAPQLSPALLRALGQKCPNLKRLCLHVADLSMVPITSLPSTLRTLELHSCEISMAWLHKQQDPTVLPLLECIVLDRVPAFRDEHLQGLTRFRALRSLVLGGTYRVTETGLDAGLQELSYLQRLEVLGCTLSADSTLLAISRHLRDVRKIRLTVRGLSAPGLAVLEGMPAL
Target-Kategorie: FBXL12
Application Verdünnung: WB: WB,1:500 - 1:2000