CORO1B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14593T
Artikelname: CORO1B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14593T
Hersteller Artikelnummer: CNA14593T
Alternativnummer: MBL-CNA14593T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 380-489 of human CORO1B (NP_065174.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 54kDa
NCBI: 57175
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: VSGRDADPILISLREAYVPSKQRDLKISRRNVLSDSRPAMAPGSSHLGAPASTTTAADATPSGSLARAGEAGKLEEVMQELRALRALVKEQGDRICRLEEQLGRMENGDA
Target-Kategorie: CORO1B
Application Verdünnung: WB: WB,1:500 - 1:2000