RYBP Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14605T
Artikelname: RYBP Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14605T
Hersteller Artikelnummer: CNA14605T
Alternativnummer: MBL-CNA14605T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human RYBP (NP_036366.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 25kDa
NCBI: 23429
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: PSVTKKNTNKKTKPKSDILKDPPSEANSIQSANATTKTSETNHTSRPRLKNVDRSTAQQLAVTVGNVTVIITDFKEKTRSSSTSSSTVTSSAGSEQQNQSSSGSESTDKGSSRSSTPKGDMSAVNDESF
Target-Kategorie: RYBP
Application Verdünnung: WB: WB,1:500 - 1:2000