DNAJB12 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14625T
Artikelname: DNAJB12 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14625T
Hersteller Artikelnummer: CNA14625T
Alternativnummer: MBL-CNA14625T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 250-409 of human DNAJB12 (NP_060096.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 42kDa
NCBI: 54788
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: NVHVYSNGRMRYTYQQRQDRRDNQGDGGLGVFVQLMPILILILVSALSQLMVSSPPYSLSPRPSVGHIHRRVTDHLGVVYYVGDTFSEEYTGSSLKTVERNVEDDYIANLRNNCWKEKQQKEGLLYRARYFGDTDMYHRAQKMGTPSCSRLSEVQASLHG
Target-Kategorie: DNAJB12
Application Verdünnung: WB: WB,1:500 - 1:2000