NDUFAB1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14657P
Artikelname: NDUFAB1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14657P
Hersteller Artikelnummer: CNA14657P
Alternativnummer: MBL-CNA14657P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-156 of human NDUFAB1 (NP_004994.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 17kDa
NCBI: 4706
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: PALVLAQVPGRVTQLCRQYSDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE
Target-Kategorie: NDUFAB1
Application Verdünnung: WB: WB,1:500 - 1:1000