RAB1A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14663T
Artikelname: RAB1A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14663T
Hersteller Artikelnummer: CNA14663T
Alternativnummer: MBL-CNA14663T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RAB1A (NP_004152.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 23kDa
NCBI: 5861
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFN
Target-Kategorie: RAB1A
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200