APH1A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14666T
Artikelname: APH1A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14666T
Hersteller Artikelnummer: CNA14666T
Alternativnummer: MBL-CNA14666T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human APH1A (NP_001071096.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 29kDa
NCBI: 51107
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: TSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQRSLLCRRQEDSRVMVYSALRIPPED
Target-Kategorie: APH1A
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:100