BATF Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14667T
Artikelname: BATF Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14667T
Hersteller Artikelnummer: CNA14667T
Alternativnummer: MBL-CNA14667T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human BATF (NP_006390.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 14kDa
NCBI: 10538
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP
Target-Kategorie: BATF
Application Verdünnung: WB: WB,1:500 - 1:2000