GFAP Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14673P
Artikelname: GFAP Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14673P
Hersteller Artikelnummer: CNA14673P
Alternativnummer: MBL-CNA14673P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human GFAP (NP_002046.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 50kDa
NCBI: 2670
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: RGTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIKESKQEHKDVM
Target-Kategorie: GFAP
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200