PPP1R14B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14677T
Artikelname: PPP1R14B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14677T
Hersteller Artikelnummer: CNA14677T
Alternativnummer: MBL-CNA14677T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 68-147 of human PPP1R14B (NP_619634.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 16kDa
NCBI: 26472
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: RLNLEEWILEQLTRLYDCQEEEIPELEIDVDELLDMESDDARAARVKELLVDCYKPTEAFISGLLDKIRGMQKLSTPQKK
Target-Kategorie: PPP1R14B
Application Verdünnung: WB: WB,1:500 - 1:2000