FIP200 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14685T
Artikelname: FIP200 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14685T
Hersteller Artikelnummer: CNA14685T
Alternativnummer: MBL-CNA14685T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1280-1400 of human FIP200 (NP_055596.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 183kDa
NCBI: 9821
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: TRGDSSSLVAELQEKLQEEKAKFLEQLEEQEKRKNEEMQNVRTSLIAEQQTNFNTVLTREKMRKENIINDLSDKLKSTMQQQERDKDLIESLSEDRARLLEEKKKLEEEVSKLRSSSFVPS
Target-Kategorie: RB1CC1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200