B4GALT4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14693T
Artikelname: B4GALT4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14693T
Hersteller Artikelnummer: CNA14693T
Alternativnummer: MBL-CNA14693T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 35-344 of human B4GALT4 (NP_003769.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 40kDa
NCBI: 8702
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: VGAIQEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPQECKALQRVAILVPHRNREKHLMYLLEHLHPFLQRQQLDYGIYVIHQAEGKKFNRAKLLNVGYLEALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLVVGRNSTGYRLRYSGYFGGVTALSREQFFKVNGFSNNYWGWGGEDDDLRLRVELQRMKISRPLPEVGKYTMVF
Target-Kategorie: B4GALT4
Application Verdünnung: WB: WB,1:500 - 1:2000