ATP6V1A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14706T
Artikelname: ATP6V1A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14706T
Hersteller Artikelnummer: CNA14706T
Alternativnummer: MBL-CNA14706T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 500-600 of human ATP6V1A (NP_001681.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 68kDa
NCBI: 523
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: SLAETDKITLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLSNMIAFYDMARRAVETTAQSDNKITWSIIREHMGDILYKLSSMKFKDPLKDGEAKIKSD
Target-Kategorie: ATP6V1A
Application Verdünnung: WB: WB,1:500 - 1:2000