CACNB3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14710T
Artikelname: CACNB3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14710T
Hersteller Artikelnummer: CNA14710T
Alternativnummer: MBL-CNA14710T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 355-484 of human CACNB3 (NP_000716.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 55kDa
NCBI: 784
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: VYWRATHHPAPGPGLLGPPSAIPGLQNQQLLGERGEEHSPLERDSLMPSDEASESSRQAWTGSSQRSSRHLEEDYADAYQDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHNHSDRNWQRNRPWPKDSY
Target-Kategorie: CACNB3
Application Verdünnung: WB: WB,1:500 - 1:2000