CD36/SR-B3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14714T
Artikelname: CD36/SR-B3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14714T
Hersteller Artikelnummer: CNA14714T
Alternativnummer: MBL-CNA14714T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human CD36/SR-B3 (NP_000063.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 53kDa
NCBI: 948
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: AFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQ
Target-Kategorie: CD36
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200