CD239/BCAM Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA14747T
Artikelname: CD239/BCAM Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA14747T
Hersteller Artikelnummer: CNA14747T
Alternativnummer: MBL-CNA14747T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 352-547 of human CD239/CD239/BCAM (NP_005572.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 67kDa
NCBI: 4059
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: KTLELRVAYLDPLELSEGKVLSLPLNSSAVVNCSVHGLPTPALRWTKDSTPLGDGPMLSLSSITFDSNGTYVCEASLPTVPVLSRTQNFTLLVQGSPELKTAEIEPKADGSWREGDEVTLICSARGHPDPKLSWSQLGGSPAEPIPGRQGWVSSSLTLKVTSALSRDGISCEASNPHGNKRHVFHFGTVSPQTSQA
Target-Kategorie: BCAM
Application Verdünnung: WB: WB,1:500 - 1:2000